-
Add to Cart The item has been addedHPA022875-100ULANTI-COASY (C005B-205894)
Price: $959.88List Price: $1,066.53COASY (Coenzyme A synthase) is mainly present in the mitochondrial matrix. The gene is mapped to human chromosome 17q12-21. -
Add to Cart The item has been addedHPA023273-100ULANTI-COASY (C005B-206053)
Price: $959.88List Price: $1,066.53COASY (Coenzyme A synthase) is mainly present in the mitochondrial matrix. The gene is mapped to human chromosome 17q12-21. -
Add to Cart The item has been addedHPA029224-100ULANTI-COG1 (C005B-207830)
Price: $959.88List Price: $1,066.53Immunogen component of oligomeric golgi complex 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA040353-100ULANTI-COG3 (C005B-211644)
Price: $1,013.20List Price: $1,125.78Immunogen component of oligomeric golgi complex 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA054470-100ULANTI-COG3 (C005B-217023)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to component of oligomeric golgi complex 3 Sequence DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA041583-100ULANTI-COG5 (C005B-212253)
Price: $1,013.20List Price: $1,125.78Immunogen component of oligomeric golgi complex 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA064645-100ULANTI-COG7 (C005B-219936)
Price: $1,013.20List Price: $1,125.78Immunogen component of oligomeric golgi complex 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA041824-100ULANTI-COG7 ANTIBODY PRODUCED IN RABBIT (C005B-212380)
Price: $1,066.53List Price: $1,185.03Immunogen component of oligomeric golgi complex 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA049429-100ULANTI-COG8 (C005B-215328)
Price: $1,013.20List Price: $1,125.78Immunogen component of oligomeric golgi complex 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA027885-100ULANTI-COIL (C005B-207312)
Price: $959.88List Price: $1,066.53Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA068537-100ULANTI-COIL (C005B-220738)
Price: $1,013.20List Price: $1,125.78Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA057480-100ULANTI-COIL ANTIBODY PRODUCED IN RABBIT (C005B-217972)
Price: $1,066.53List Price: $1,185.03Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human
