-
Add to Cart The item has been addedHPA017661-100ULANTI-CYP4X1 ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen cytochrome P450, family 4, subfamily X, polypeptide 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA017761-100ULANTI-CYP7B1 (C005B-204611)
Price: $1,210.58List Price: $1,345.09The gene encoding 25-hydroxycholesterol 7-α-hydroxylase (CYP7B1) is localized on chromosome 8. Immunogen Cytochrome P450 7B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedSAB4502455-100UGANTI-CYSLTR2 ANTIBODY PRODUCED IN RABBIT (C005B-475582)
Price: $1,005.90List Price: $1,117.67General description Anti-CYSLTR2 Antibody detects endogenous levels of total CYSLTR2 protein. Immunogen The antiserum was produced against synthesized peptide derived from human CYSLTR2. -
Add to Cart The item has been addedMABX719-1KCANTI-CYSTATIN C CLONE 19
Price: $2,106.05List Price: $2,340.06General description Antibody binds Cystatin C a marker traditionally used in the detection of Chronic Kidney Disease (CKD). More recently there has been increasing evidence that the level of Cystatin C can be linked to hardening of arteries and -
Add to Cart The item has been addedHPA060662-100ULANTI-CYTH2 (C005B-218874)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to cytohesin 2 Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA071573-100ULANTI-CYTH4 ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen cytohesin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA067201-100ULANTI-CYTL1 (C005B-220495)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to cytokine like 1 Sequence TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA067201-100Anti-CYTL1 cytokine like 1, 100ul UN 1687 6.1 PG2
Price: $1,840.19List Price: $2,044.65Anti-CYTL1 cytokine like 1, 100ul UN 1687 6.1 PG2 -
Add to Cart The item has been added600-401-HB7Anti-Cytochrome P450 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $1,500.62List Price: $1,667.35Anti-Cytochrome p450 has been tested in Western Blot, Immunofluorescence and Immunohistochemistry. Expect a band at ~58kda in western blot using appropriate lysates. -
Add to Cart The item has been added600-401-HB7SAnti-Cytochrome P450 (RABBIT) Antibody, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Anti-Cytochrome p450 has been tested in Western Blot, Immunofluorescence and Immunohistochemistry. Expect a band at ~58kda in western blot using appropriate lysates. -
Add to Cart The item has been addedSAB5703035-100ULANTI-CYTOKERATIN 1 (KRT1) ANTIBODY CLONE 10W8J6 RABBIT MONOCLONAL
Price: $780.44List Price: $867.15ANTI-CYTOKERATIN 1 (KRT1) ANTIBODY CLONE 10W8J6 RABBIT MONOCLONAL -
Add to Cart The item has been addedCBL266ANTI-CYTOKERATIN 1 ANTIBODY 10 CLONE LH1
Price: $608.93List Price: $676.59Specificity This antibody reacts with the suprabasal cells of stratified squamous epithelia in human, murine and porcine species. Immunogen Keratin 1 and 10.
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.