-
Add to Cart The item has been addedHPA041752-100ULANTI-CRAMP1 (C005B-212343)
Price: $1,013.20List Price: $1,125.78Immunogen cramped chromatin regulator homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA019230-100ULANTI-CRAT (C005B-205043)
Price: $959.88List Price: $1,066.53CRAT (carnitine O -acetyltransferase) localizes in peroxisomes and the mitochondrial matrix. It is strongly expressed in skeletal muscle and heart. -
Add to Cart The item has been added600-401-270Anti-CREB pS133 (RABBIT) Antibody, 100 L, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-CREB pS133 antibody reacts with phosphorylated human CREB at pS133 and shows minimal reactivity by western blot with non-phosphorylated CREB and minimal reactivity (1%) by ELISA against the non-phosphorylated form of the immunizing peptide. -
Add to Cart The item has been addedHPA055861-100ULANTI-CREBBP ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen CREB binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA001818-100ULANTI-CREM (C005B-201500)
Price: $1,066.53List Price: $1,185.03Anti-cAMP responsive element modulator (CREM) is encoded by the gene mapped to human chromosome 10p11.21. -
Add to Cart The item has been addedHPA036234-100ULANTI-CRHBP ANTIBODY PRODUCED IN RABBIT (C005B-209809)
Price: $1,066.53List Price: $1,185.03Immunogen corticotropin releasing hormone binding protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA042462-100ULANTI-CRIP1
Price: $1,013.20List Price: $1,125.78Immunogen cysteine-rich protein 1 (intestinal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA042664-100ULANTI-CRIP2 (C005B-212775)
Price: $1,013.20List Price: $1,125.78Immunogen cysteine-rich protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA036198-100ULANTI-CRIP3
Price: $1,013.20List Price: $1,125.78Immunogen cysteine-rich protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been added600-401-997Anti-Cripto-1 (TDGF1) (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $868.42List Price: $964.91This affinity purified antibody has been tested for use in ELISA and western blotting. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been added600-401-997SAnti-Cripto-1 (TDGF1) (RABBIT) Antibody, 25 L, Liquid (sterile filtered)
Price: $272.84List Price: $303.16This affinity purified antibody has been tested for use in ELISA and western blotting. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedHPA030534-100ULANTI-CRISP1 (C005B-208369)
Price: $959.88List Price: $1,066.53Immunogen Recombinant protein corresponding to cysteine rich secretory protein 1 Sequence TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated
