-
Add to Cart The item has been addedHPA071178-100ULANTI-CRYBA4 (C005B-221212)
Price: $1,013.20List Price: $1,125.78Immunogen crystallin, beta A4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA003448-100ULANTI-CRYBB1 (C005B-201989)
Price: $959.88List Price: $1,066.53Immunogen Recombinant protein corresponding to crystallin beta B1 Sequence TTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQE Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedHPA055840-100ULANTI-CRYBB3 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen crystallin, beta B3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA035103-100ULANTI-CRYGS (C005B-209285)
Price: $1,013.20List Price: $1,125.78Immunogen crystallin, gamma S recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA040403-100ULANTI-CRYL1 (C005B-211674)
Price: $1,013.20List Price: $1,125.78Immunogen crystallin, lambda 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA019086-100ULANTI-CRYM (C005B-204984)
Price: $959.88List Price: $1,066.53The gene CRYM (μ-crystallin) is mapped to human chromosome 16p. CRYM is also referred as THBP (NADP-regulated thyroid-hormone-binding protein). -
Add to Cart The item has been addedHPA023290-100ULANTI-CRYZ (C005B-206061)
Price: $959.88List Price: $1,066.53The gene CRYZ (crystallin ζ) is mapped to human chromosome 1p31. It belongs to the quinone oxidoreductase (QOR) family. -
Add to Cart The item has been addedHPA038460-100ULANTI-CS ANTIBODY PRODUCED IN RABBIT (C005B-210784)
Price: $1,013.20List Price: $1,125.78Immunogen citrate synthase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA038461-100ULANTI-CS ANTIBODY PRODUCED IN RABBIT (C005B-210785)
Price: $1,013.20List Price: $1,125.78Immunogen citrate synthase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedMABC1711-25ULANTI-CSBAP31 CLONE 297-D4 (C005B-451671)
Price: $346.00List Price: $384.45General description H9 human embryonic stem cells. Application ELISA Analysis: A representative lot detected csBAP31 in ELISA applications (Kim, WT. -
Add to Cart The item has been addedMABC1711-100ULANTI-CSBAP31 CLONE 297-D4 (C005B-451672)
Price: $820.37List Price: $911.52General description H9 human embryonic stem cells. Application ELISA Analysis: A representative lot detected csBAP31 in ELISA applications (Kim, WT. -
Add to Cart The item has been addedHPA052221-100ULANTI-CSDE1 ANTIBODY PRODUCED IN RABBIT (C005B-216302)
Price: $1,013.20List Price: $1,125.78Immunogen cold shock domain containing E1, RNA-binding Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
