Immunological testing systems and components

Immunogen cullin 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Monoclonal Anti-Cul7 (mouse IgG2b isotype) is derived from the hybridoma Ab38 produced by the fusion of mouse myeloma cells (P3X63Ag8.653) and splenocytes from BALB/c mice immunized with mouse Cul7.

Immunogen cullin 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen cutC copper transporter Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Peptidyl-prolyl cis-trans isomerase SDCCAG10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Anti-CX3CL1 Antibody has been tested for use in ELISA, Western Blotting and Immunoprecipitation. Specific conditions for reactivity should be optimized by the end user.

Immunogen chemokine (C-X3-C motif) receptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to C-X3-C motif chemokine receptor 1 Sequence KENECLGDYPEVLQEIWPVLRNVETN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to C-X3-C motif chemokine receptor 1 Sequence HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen coxsackie virus and adenovirus receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen coxsackie virus and adenovirus receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Immunogen Sequence: GI # 4504701 , sequence 22-98 Recombinant small inducible cytokine B10 Application Anti-CXCL10 antibody produced in chicken is suitable for indirect ELISA and western blotting analysis at a dilution of 1:500, for