Immunological testing systems and components

Immunogen DC-STAMP domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen dopachrome tautomerase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Dynactin-2 (DCTN2), also known as dynamitin, is located on human chromosome 12q13-q15. Dynamitin is a constituent of the microtubule-binding multiprotein complex, dynactin.

Immunogen Synthetic peptide directed towards the N terminal region of human DCTN2 Sequence Synthetic peptide located within the following region: ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI Physical form Purified antibody supplied in

Immunogen dynactin 3 (p22) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen dynactin 5 (p25) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Dynactin subunit 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Dynactin subunit 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen DET1 and DDB1 associated 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen dimethylarginine dimethylaminohydrolase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen dimethylarginine dimethylaminohydrolase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive