-
Add to Cart The item has been addedHPA076543-100ULANTI-ERRFI1 ANTIBODY PRODUCED IN RABBIT (C005B-222109)
Price: $1,210.58List Price: $1,345.09Immunogen ERBB receptor feedback inhibitor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA017209-100ULANTI-ERV3-1 (C005B-204505)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to endogenous retrovirus group 3, member 1 Sequence QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA Application All -
Add to Cart The item has been addedHPA046508-100ULANTI-ERV3-1 (C005B-214276)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to endogenous retrovirus group 3 member 1 Sequence VCYDPKSSPGIWFEIHVGSKEGDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSMEYYSSCHKNRYAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSVNLTILEPDQPIWTTGLKAPL Application -
Add to Cart The item has been addedHPA011423-100ULANTI-ERVMER34-1 ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09ERVMER34-1 (Endogenous retrovirus group MER34, member 1) is expressed by normal blood cells and is involved in various biological functions such as pathogenesis of human diseases. It possesses a property to directly bind and inactivate tumor -
Add to Cart The item has been addedHPA076115-100ULANTI-ERVV-1 ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen endogenous retrovirus group V member 1, envelope Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedE2531-1MGANTI-ERYTHROPOIETIN
Price: $1,128.05List Price: $1,253.39Epo is mainly produced by liver cells in fetal stages, by kidneys under hypoxic conditions liver and brain also secrete Epo in less amounts. Anti-Erythropoietin antibody specifically reacts with human Erythropoietin. -
Add to Cart The item has been addedHPA039700-100ULANTI-ESD (C005B-211355)
Price: $1,210.58List Price: $1,345.09Immunogen esterase D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA073188-100ULANTI-ESPL1 ANTIBODY PRODUCED IN RABBIT
Price: $1,101.69List Price: $1,224.10Immunogen extra spindle pole bodies like 1, separase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB4300344-100UGANTI-ESR1 (AB-104) ANTIBODY PRODUCED IN RABBIT
Price: $876.57List Price: $973.97Immunogen Peptide sequence around aa. 102-106 (S-V-S-P-S), according to the protein ESR1. -
Add to Cart The item has been addedSAB4300345-100UGANTI-ESR1 (AB-106) ANTIBODY PRODUCED IN RABBIT
Price: $876.57List Price: $973.97General description Estrogen receptor 1 (ESR1) encodes estrogen receptor α: (ERα:) protein, otherwise known as nuclear receptor subfamily 3, group A, member 1 (NR3A1), binds to estrogen. High expression of ERα: is observed in tissues -
Add to Cart The item has been addedHPA000449-100ULANTI-ESR1 (C005B-201058)
Price: $1,039.98List Price: $1,155.53Immunogen Estrogen receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA000450-100ULANTI-ESR1 (C005B-201059)
Price: $1,039.98List Price: $1,155.53Immunogen Estrogen receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.