-
Add to Cart The item has been addedMABC779ANTI-FOLATE CLONE 8/33 (MOUSE MONOCLONAL)
Price: $932.26List Price: $1,035.84Immunogen KLH-conjugated Tetrahydrofolic acid corresponding to Folate. Application Anti-Folate, clone 8/33 | MABC779 is an antibody against Folate for use in ELISA. -
Add to Cart The item has been added200-106-148SAnti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody Biotin Conjugated, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Anti-Folate Binding Protein has been assayed against 1.0 ug of Folate Binding Protein in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as -
Add to Cart The item has been added200-103-148-0100Anti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody Peroxidase Conjugated, 100 g, Lyophilized
Price: $1,443.47List Price: $1,603.86Anti-Folate Binding Protein has been assayed against 1.0 ug of Folate Binding Protein [Bovine Milk] in a standard capture ELISA using ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room -
Add to Cart The item has been added200-103-148SAnti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody Peroxidase Conjugated, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Anti-Folate Binding Protein has been assayed against 1.0 ug of Folate Binding Protein [Bovine Milk] in a standard capture ELISA using ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room -
Add to Cart The item has been added200-101-148-0100Anti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody, 100 g, Lyophilized
Price: $1,500.62List Price: $1,667.35FOLATE BINDING PROTEIN Antibody has been assayed against 1.0 ug of Folate Binding Protein [Bovine Milk] in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG [H&L] (Rabbit) code #605-4302 and (ABTS -
Add to Cart The item has been added200-101-148SAnti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86FOLATE BINDING PROTEIN Antibody has been assayed against 1.0 ug of Folate Binding Protein [Bovine Milk] in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG [H&L] (Rabbit) code #605-4302 and (ABTS -
Add to Cart The item has been added100-101-148Anti-FOLATE BINDING PROTEIN (Bovine Milk) (GOAT) Antibody, 2mL, Lyophilized
Price: $4,120.25List Price: $4,578.05This product has been assayed against 1.0 ug of Folate Binding Protein [Bovine Milk] in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG [H&L] (Goat) code #611-1302 and (ABTS -
Add to Cart The item has been addedHPA010593-100ULANTI-FOLH1 (C005B-203291)
Price: $1,101.69List Price: $1,224.10FOLH1 (folate hydrolase 1) is a type II membrane protein, which is composed of a cytosolic domain, a transmembrane region, and an exoplasmic region. This protein exhibits both constitutive and induced internalization. -
Add to Cart The item has been addedSAB4500989-100UGANTI-FOLR1 ANTIBODY PRODUCED IN RABBIT (C005B-324422)
Price: $1,005.90List Price: $1,117.67General description The folate receptor 1 (FOLR1) gene encodes for folate receptor α: protein, a membrane-bound glycoprotein. The FOLR1 gene is mapped on the human chromosome at 11q13. -
Add to Cart The item has been addedHPA030728-100ULANTI-FOSL1 ANTIBODY PRODUCED IN RABBIT (C005B-208435)
Price: $1,101.69List Price: $1,224.10Immunogen FOS like 1, AP-1 transcription factor subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB2100835-100ULANTI-FOXA1 (C005B-331666)
Price: $976.72List Price: $1,085.24Immunogen Synthetic peptide directed towards the N terminal region of human FOXA1 Sequence Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM Physical form Purified antibody supplied in -
Add to Cart The item has been added600-401-BG0Anti-FOXA1 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $1,662.41List Price: $1,847.13Anti-FOXA1 Antibody has been tested for use in ELISA and Western Blotting. Specific conditions for reactivity should be optimized by the end user. Expect a band at approximately 49 kDa in Western Blots of specific cell lysates and tissues.
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.