-
Add to Cart The item has been addedHPA005561-100ULANTI-GUCA1A (C005B-202375)
Price: $1,210.58List Price: $1,345.09Immunogen guanylate cyclase activator 1A (retina) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA075056-100ULANTI-GUCA1A ANTIBODY PRODUCED IN RABBIT (C005B-221881)
Price: $1,210.58List Price: $1,345.09Immunogen guanylate cyclase activator 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA041597-100ULANTI-GUCA1C (C005B-212258)
Price: $1,210.58List Price: $1,345.09Guanylate cyclase activator 1C (GUCA1C), also known as guanylate cyclase activating protein 3 (GCAP3), is encoded by the gene mapped to human chromosome 3q13.1. -
Add to Cart The item has been addedHPA056004-100ULANTI-GUCY1A3 ANTIBODY PRODUCED IN RABBIT (C005B-217530)
Price: $1,101.69List Price: $1,224.10Immunogen guanylate cyclase 1, soluble, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA058617-100ULANTI-GUCY1A3 (C005B-218306)
Price: $1,101.69List Price: $1,224.10Immunogen Recombinant protein corresponding to guanylate cyclase 1 soluble subunit alpha Sequence PPCFHNDCSEFVNQPYLLYSVHMKSTKPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIR Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA003934-100ULANTI-GUF1 (C005B-202124)
Price: $1,210.58List Price: $1,345.09Immunogen GTP-binding protein GUF1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedSAB3700353-2MGANTI-GUINEA PIG IGG (FC SPECIFIC)-BIOTIN ANTIBODY PRODUCED IN GOAT
Price: $605.34List Price: $672.60Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Guinea Pig IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by -
Add to Cart The item has been addedSAB3700351-2MGANTI-GUINEA PIG IGG (FC SPECIFIC)-PEROXIDASE ANTIBODY PRODUCED IN GOAT
Price: $605.34List Price: $672.60Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Guinea Pig IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by -
Add to Cart The item has been added606-106-129Anti-GUINEA PIG IgG (H&L) (GOAT) Antibody Biotin Conjugated (Min X Bv Ch Gt Ham Hs Hu Ms Rb Rt & Sh Serum Proteins), 1mg, Lyophilized
Price: $857.47List Price: $952.74Anti-Guinea Pig (H&L) biotin conjugated antibody generated in goat detects specifically guinea pig IgG (H&L). This secondary biotin conjugated antibody anti-Guinea Pig is ideal for investigators who routinely perform titration assays, western-blot, -
Add to Cart The item has been added606-1602Anti-GUINEA PIG IgG (H&L) (GOAT) Antibody Biotin Conjugated, 2mg, Lyophilized
Price: $591.46List Price: $657.18Anti-Guinea Pig (H&L) biotin conjugated antibody generated in goat detects specifically guinea pig IgG (H&L). This secondary biotin conjugated antibody anti-Guinea Pig is ideal for investigators who routinely perform titration assays, western-blot, -
Add to Cart The item has been added606-103-129Anti-GUINEA PIG IgG (H&L) (GOAT) Antibody Peroxidase Conjugated (Min X Bv Ch Gt Ham Hs Hu Ms Rb Rt & Sh Serum Proteins), 1mg, Lyophilized
Price: $813.70List Price: $904.12Anti-Guinea Pig IgG HRP is suitable for immunoblotting, western blot, dot blot, ELISA, immunoperoxidase electron microscopy and immunohistochemistry as well as other peroxidase-antibody based enzymatic assays requiring lot-to-lot consistency. -
Add to Cart The item has been added206-1102Anti-GUINEA PIG IgG (H&L) (GOAT) Antibody, 50mg, Lyophilized
Price: $1,802.39List Price: $2,002.65Anti-Guinea Pig IgG antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency.
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.