-
Add to Cart The item has been added608-1603Anti-HORSE IgG F(c) (GOAT) Antibody Biotin Conjugated, 2mg, Lyophilized
Price: $696.48List Price: $773.86This product has been assayed against 1.0 ug of Horse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes a -
Add to Cart The item has been added608-1303Anti-HORSE IgG F(c) (GOAT) Antibody Peroxidase Conjugated, 2mg, Lyophilized
Price: $734.98List Price: $816.65Anti-Horse IgG F(c) Peroxidase conjugate is suitable for immunoblotting (western or dot blot), ELISA, immunoelectron microscopy and immunohistochemistry as well as other antibody-based enzymatic assays requiring lot-to-lot consistency. -
Add to Cart The item has been added608-1103Anti-HORSE IgG F(c) (GOAT) Antibody, 2mg, Liquid (sterile filtered)
Price: $502.08List Price: $557.87Anti-Horse IgG F(c) antibody is suitable for ELISA, Western Blot and Immunohistochemistry applications. Antibody should be optimized by end user for specific reactive conditions. -
Add to Cart The item has been added608-4603Anti-HORSE IgG F(c) (RABBIT) Antibody Biotin Conjugated, 1.5mg, Lyophilized
Price: $734.98List Price: $816.65This product has been assayed against 1.0 ug of Horse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes a -
Add to Cart The item has been added608-4303Anti-HORSE IgG F(c) (RABBIT) Antibody Peroxidase Conjugated, 1.5mg, Lyophilized
Price: $679.57List Price: $755.08This product has been assayed against 1.0 ug of Horse IgG in a standard capture ELISA using ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room temperature. -
Add to Cart The item has been addedCLAG10340Anti-Horse IgG(H+L)IgG Fraction,(Poly,rabbit IgG)20mg
Price: $883.62List Price: $981.80Anti-Horse IgG(H+L)IgG Fraction,(Poly,rabbit IgG)20mg -
Add to Cart The item has been addedSAB3700178-2MLANTI-HORSE IGM (μ-CHAIN SPECIFIC) ANTIBODY PRODUCED IN RABBIT
Price: $521.15List Price: $579.05Specificity This product was prepared from monospecific antiserum by a delipidation and defibrination. Assay by immunoelectrophoresis resulted in a single precipitin arc against Horse IgM and Horse Serum. -
Add to Cart The item has been added208-4307Anti-HORSE IgM mu chain (RABBIT) Antibody Peroxidase Conjugated, 20mg, Lyophilized
Price: $1,799.42List Price: $1,999.36This product has been assayed against 1.0 ug of Horse IgM in a standard capture ELISA using ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes at room temperature. -
Add to Cart The item has been addedSAB2107858-100ULANTI-HOXA10 (C005B-330486)
Price: $781.37List Price: $868.19Immunogen Synthetic peptide directed towards the N terminal region of human HOXA10 Sequence Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP Physical form Purified antibody supplied in -
Add to Cart The item has been addedHPA044576-100ULANTI-HOXB1 (C005B-213636)
Price: $1,210.58List Price: $1,345.09Immunogen homeobox B1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA047857-100ULANTI-HOXB2 (C005B-214764)
Price: $1,210.58List Price: $1,345.09Immunogen homeobox B2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA057432-100ULANTI-HOXB4 ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen homeobox B4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The
Immunological testing systems and components
Browse our curated selection of Immunological testing systems and components from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Immunological testing systems and components
Cenmed Enterprises provides a comprehensive selection of Immunological testing systems and components products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.