-
Add to Cart The item has been addedHPA011179-100ULANTI-ACMSD (C005B-203432)
Price: $959.88List Price: $1,066.53ACMSD (α-amino-β-carboxymuconate-epsilon-semialdehyde decarboxylase) is an amidohydrolase, which is dependent on zinc for its activity. It is a 40kDa cytoplasmic protein. -
Add to Cart The item has been addedHPA060170-100ULANTI-ACOT2
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to acyl-CoA thioesterase 2 Sequence MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA057655-100ULANTI-ACP5 ANTIBODY PRODUCED IN RABBIT (C005B-218022)
Price: $1,013.20List Price: $1,125.78Immunogen acid phosphatase 5, tartrate resistant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059463-100ULANTI-ACP5 ANTIBODY PRODUCED IN RABBIT (C005B-218555)
Price: $1,013.20List Price: $1,125.78Immunogen acid phosphatase 5, tartrate resistant Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063916-100ULANTI-ACPP ANTIBODY PRODUCED IN RABBIT (C005B-219775)
Price: $1,013.20List Price: $1,125.78Immunogen acid phosphatase, prostate Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA023476-100ULANTI-ACRC (C005B-206139)
Price: $959.88List Price: $1,066.53The gene ACRC (acidic repeat containing) is mapped to human chromosome Xq13.1 and contains at least 12 exons and 11 introns. -
Add to Cart The item has been addedHPA041642-100ULANTI-ACSBG1 ANTIBODY PRODUCED IN RABBIT (C005B-212281)
Price: $1,013.20List Price: $1,125.78Immunogen acyl-CoA synthetase bubblegum family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA051013-100ULANTI-ACSBG2 ANTIBODY PRODUCED IN RABBIT (C005B-215859)
Price: $1,013.20List Price: $1,125.78Immunogen acyl-CoA synthetase bubblegum family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071021-100ULANTI-ACSL3 (C005B-221174)
Price: $1,013.20List Price: $1,125.78Immunogen acyl-CoA synthetase long-chain family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA000286-100ULANTI-ACSL4 (C005B-201028)
Price: $959.88List Price: $1,066.53Immunogen acyl-CoA synthetase long-chain family member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA007162-100ULANTI-ACSL5 ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Immunogen acyl-CoA synthetase long-chain family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA057699-100ULANTI-ACSM2A ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen acyl-CoA synthetase medium-chain family member 2A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
