Immunological testing systems and components

AFM (afamin) is a 75kDa vitamin E-binding glycoprotein belonging to the albumin gene family. It consists of four or five potential N-glycosylation sites.

Immunogen Recombinant protein corresponding to afamin Sequence EMEKLVKDMVEYKDRCMADKTLPECSKLPNNVLQEKICAMEGLPQKHNFSHCCSKVDAQRRLCFFYNKKSDVGFLPPFPTLDPEEKCQAYESNRESLLNHFLYEVARRNPFVFAPTLLTVAVHFEEVAKSCCEEQNKVNCLQTRAIPV Application All Prestige Antibodies

AFP (&#945 fetoprotein) is a 70kDa serum glycoprotein, and is produced during gestation from fetal liver and yolk sac. Immunogen &#945-Fetoprotein precursor recombinant protein epitope signature tag (PrEST) Application Anti-AFP antibody produced

The gene AFP (alpha fetoprotein) encodes a plasma glycoprotein that has a molar mass of 70kDa. The gene is mapped to human chromosome 4.

General description This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma.

Immunogen aspartylglucosaminidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen aspartylglucosaminidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ArfGAP with GTPase domain, ankyrin repeat and PH domain 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen ATP/GTP binding protein-like 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Specificity AGE (Advanced Glycation End-products) Immunogen Glycoaldehyde-modified protein. Application Anti-AGE (Advanced Glycation End-products) Antibody detects level of AGE (Advanced Glycated End-products) &amp has been published &amp