Immunological testing systems and components

Immunogen Recombinant protein corresponding to cytohesin 2 Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen cytohesin 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cytokine like 1 Sequence TCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVAS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Anti-CYTL1 cytokine like 1, 100ul UN 1687 6.1 PG2

Anti-Cytochrome p450 has been tested in Western Blot, Immunofluorescence and Immunohistochemistry. Expect a band at ~58kda in western blot using appropriate lysates.

Anti-Cytochrome p450 has been tested in Western Blot, Immunofluorescence and Immunohistochemistry. Expect a band at ~58kda in western blot using appropriate lysates.

ANTI-CYTOKERATIN 1 (KRT1) ANTIBODY CLONE 10W8J6 RABBIT MONOCLONAL

Specificity This antibody reacts with the suprabasal cells of stratified squamous epithelia in human, murine and porcine species. Immunogen Keratin 1 and 10.

General description Cytokeratins are a subfamily of intermediate filament proteins and are characterized by a remarkable biochemical diversity, represented in epithelial tissues by at least 20 different polypeptides. They range in molecular weight

General description A cytoskeletal preparation of the human hepatocellular carcinoma cell line Hep3B. Application Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Cytokeratin-8 in human prostate

General description A cytoskeletal preparation of the human hepatocellular carcinoma cell line Hep3B. Application Immunohistochemistry (Paraffin) Analysis: A 1:250 dilution from a representative lot detected Cytokeratin-8 in human prostate

General description Intermediate filaments (IFs) are one of three major cytoskeletal filament assemblies in higher eukaryotes.6 Keratins (formerly known as “cytokeratins”) comprise of types I and II IF genes (given a total of 54 conserve